missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30197317

Invitrogen™ Human RANK (aa 261-379) Control Fragment Recombinant Protein

Product Code. 30197317
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30197317

Brand: Invitrogen™ RP90287

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (54%), Rat (54%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110945 (PA5-110945. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RANK is a member of the tumor necrosis factor receptor (TNFR) family. The full length mouse RANK cDNA encodes a type I transmembrane protein with an extracellular and a cytoplasmic domain. The extracellular domain contains two potential N-linked glycosylation sites. RANK shares significant amino acid homology with other members of the TNFR family in its extracellular four cysteine-rich repeats. Human and murine RANK share 81% amino acid identity in their extracellular domains.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9Y6Q6
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 8792
Name Human RANK (aa 261-379) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias CD265; FEO; LOH18CR1; loss of heterozygosity, 18, chromosomal region 1; Ly109; mRANK; ODFR; OFE; OPTB7; Osteoclast differentiation factor receptor; OSTS; Paget disease of bone 2; PDB2; Rank; receptor activator of NF-kappaB; receptor activator of NF-KB; receptor activator of nuclear factor-kappa B; RGD1563614; TNF receptor superfamily member 11 A; Tnfrsf11a; TRANCER; TRANCE-R; tumor necrosis factor receptor superfamily member 11 A; tumor necrosis factor receptor superfamily member 11 A, NFKB activator; tumor necrosis factor receptor superfamily, member 11 A, NFKB activator
Common Name RANK (CD265)
Gene Symbol TNFRSF11A
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KESSGDSCVSTHTANFGQQGACEGVLLLTLEEKTFPEDMCYPDQGGVCQGTCVGGGPYAQGEDARMLSLVSKTEIEEDSFRQMPTEDEYMDRPSQPTDQLLFLTEPGSKSTPPFSEPLE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.