missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human RANGAP1 (aa 11-105) Control Fragment Recombinant Protein

Product Code. 30208609
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30208609

Brand: Invitrogen™ RP101150

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83992 (PA5-83992. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Ran is a small signaling GTPase that is involved in nucleocytoplasmic transport. Two additional functions of animal Ran in the formation of spindle asters and the reassembly of the nuclear envelope in mitotic cells have been recently reported. In contrast to Ras or Rho, Ran is not associated with membranes. Instead, the spatial sequestering of its accessory proteins, the Ran GTPase-activating protein RanGAP and the nucleotide exchange factor RCC1, appears to define the local concentration of RanGTP vs. RanGDP involved in signaling. Mammalian RanGAP is bound to the nuclear pore by a mechanism involving the attachment of small ubiquitin-related modifier protein (SUMO) to its C terminus and the subsequent binding of the SUMOylated domain to the nucleoporin Nup358.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P46060
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5905
Name Human RANGAP1 (aa 11-105) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias C79654; fug1; KIAA1835; MGC20266; mKIAA1835; RAN GTPase activating protein 1; RAN GTPase activating protein 1 A; Ran GTPase activating protein 1 b; Ran GTPase activating protein 1 L homeolog; Ran GTPase activating protein 1 S homeolog; ran GTPase-activating protein 1; RANGAP; RanGAP1; rangap1.L; rangap1.S; rangap1a; rangap1-a; rangap1b; rangap1-b; rna1p; SD; segregation distorter homolog; segregation distortion; XELAEV_18023679mg; XELAEV_18025680mg
Common Name RANGAP1
Gene Symbol RANGAP1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ETLAKTQVAGGQLSFKGKSLKLNTAEDAKDVIKEIEDFDSLEALRLEGNTVGVEAARVIAKALEKKSELKRCHWSDMFTGRLRTEIPPALISLGE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.