Invitrogen™ Human RANBP3 (aa 471-541) Control Fragment Recombinant Protein

Product Code.	Quantity	unitSize
30181185	100 μL	100µL

Product Code. 30181185 Supplier Invitrogen™ Supplier No. RP98868

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Ran binding protein 3 (RanBP3) is a member of Ran GTPase binding proteins that is located at the nuclear pore complex (NPC) and plays an essential role in the transport between cytoplasm and nucleus. RANPB3 is expessed as two spliced forms, RanBP3a and RanBP3b, both of which contains two FXFG motifs, characteristic of a subgroup of nucleoporins in addition to nuclear localization signal in the amino-terminal region (amino acid residues 40-57) and a unique acidic carboxyl terminus which is integral to its switch function.

Specifications

• Accession Number: Q9H6Z4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 8498
• Name: Human RANBP3 (aa 471-541) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2610024N24Rik; AA408221; RAN binding protein 3; RANB3; ran-binding protein 3; RAN-binding protein-3; Ranbp3
• Common Name: RANBP3
• Gene Symbol: RANBP3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KSIRITAMDTEDQGVKVFLISASSKDTGQLYAALHHRILALRSRVEQEQEAKMPAPEPGAAPSNEEDDSDD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining