Invitrogen™ Human RanBP16 (aa 526-591) Control Fragment Recombinant Protein

Product Code. 30199275

Brand: Invitrogen™ RP100395

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111187 (PA5-111187. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The transport of protein and large RNAs through the nuclear pore complexes is an energy-dependent and regulated process. The import of proteins with a nuclear localization signal is accomplished by recognition of one or more clusters of basic amino acids by the importin-alpha/beta complex; see MIM 600685 and MIM 602738. The small GTPase RAN plays a key role in NLS-dependent protein import. RAN-binding protein-16 is a member of the importin-beta superfamily of nuclear transport receptors.

Specifications

• Accession Number: Q9UIA9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 23039
• Name: Human RanBP16 (aa 526-591) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4930506C02Rik; BB164534; EXP7; exportin 7; exportin-7; Kiaa0745; mKIAA0745; RAN binding protein 16; ran-binding protein 16; Ranbp16; Xpo7
• Common Name: RanBP16
• Gene Symbol: Xpo7
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RVLQLMNLTDSRLAQAGNEKLELAMLSFFEQFRKIYIGDQVQKSSKLYRRLSEVLGLNDETMVLSV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining