Invitrogen™ Human RALGAPB (aa 1155-1258) Control Fragment Recombinant Protein

Product Code. 30180574

Brand: Invitrogen™ RP99448

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62410 (PA5-62410. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Non-catalytic subunit of the heterodimeric RalGAP1 and RalGAP2 complexes which act as GTPase activators for the Ras-like small GTPases RALA and RALB.

Specifications

• Accession Number: Q86X10
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 57148
• Name: Human RALGAPB (aa 1155-1258) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 9330195P16; AI507211; B230339M05Rik; DKFZp781M2411; KIAA1219; mKIAA1219; p170; p170 {ECO:0000303; PubMed:19520869}; Ral GTPase activating protein non-catalytic beta subunit; Ral GTPase activating protein non-catalytic subunit beta; Ral GTPase activating protein, beta subunit (non-catalytic); ral GTPase-activating protein beta subunit; ral GTPase-activating protein subunit beta; ralgapb; ralgapb {ECO:0000303; RalGAPbeta; RGD1306861; zmp:0000000942
• Common Name: RALGAPB
• Gene Symbol: RALGAPB
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LPCRPFDTVFIFYMKPGQKTNQEILKNVESSRTVQPHFLEFLLSLGWSVDVGRHPGWTGHVSTSWSINCCDDGEGSQQEVISSEDIGASIFNGQKKVLYYADAL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining