Invitrogen™ Human RALGAPA2 (aa 821-898) Control Fragment Recombinant Protein

Product Code. 30181659

Brand: Invitrogen™ RP99469

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60441 (PA5-60441. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Catalytic subunit of the heterodimeric RalGAP2 complex which acts as a GTPase activator for the Ras-like small GTPases RALA and RALB.

Specifications

• Accession Number: Q2PPJ7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 57186
• Name: Human RALGAPA2 (aa 821-898) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 250 kDa substrate of Akt; A230067G21Rik; akt substrate AS250; AS250; bA287B20.1; BC053994; C20orf74; dJ1049G11; dJ1049G11.4; Kiaa1272; p220; pp250; Ral GTPase activating protein catalytic alpha subunit 2; Ral GTPase activating protein, alpha subunit 2 (catalytic); ral GTPase-activating protein alpha subunit 2; ral GTPase-activating protein subunit alpha-2; RALGAPA2; RapGAPalpha2; RGC2
• Common Name: RALGAPA2
• Gene Symbol: RALGAPA2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SPAELDLKDDLQQTQGKCRERQKSESTNSDTTLGCTNEAELSMGPWQTCEEDPELNTPTDVVADADARHWLQLSPTDA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining