Invitrogen™ Human RAI3 (aa 268-339) Control Fragment Recombinant Protein

Product Code. 30197760

Brand: Invitrogen™ RP89541

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110739 (PA5-110739. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Retinoic acid plays a critical role in development, cellular growth, and differentiation. The specific function for this retinoic acid-induced gene has not yet been determined; however, it may play a role in embryonic development and epithelial cell differentiation. This gene is a member of the type 3 G protein-coupling receptor family, characterized by the signature 7-transmembrane domain motif. This gene may also be involved in interaction between retinoid acid and G protein signalling pathways. RAI3 has been reported in lung, kidney, colon, pancreas, prostate, and small intestine. ESTs have been isolated from amnion, breast, colon, eye, lung, nasal cavity, placenta, skin, uterus, and vessel libraries.

Specifications

• Accession Number: Q8NFJ5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9052
• Name: Human RAI3 (aa 268-339) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: G protein-coupled receptor class C group 5 member A; G protein-coupled receptor, class C, group 5, member A; G protein-coupled receptor, family C, group 5, member A; GPCR5A; Gprc5a; G-protein coupled receptor family C group 5 member A; orphan G-protein-coupling receptor PEIG-1; PEIG-1; Phorbol ester induced gene 1; phorbol ester induced protein-1; Rai3; Raig1; RAIG-1; retinoic acid induced 3; retinoic acid responsive; retinoic acid-induced gene 1 protein; Retinoic acid-induced protein 3; TIG1; TPA induced gene 1
• Common Name: RAI3
• Gene Symbol: GPRC5A
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LTKQRNPMDYPVEDAFCKPQLVKKSYGVENRAYSQEEITQGFEETGDTLYAPYSTHFQLQNQPPQKEFSIPR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining