Invitrogen™ Human RAE1 (aa 284-368) Control Fragment Recombinant Protein

Product Code. 30209653

Brand: Invitrogen™ RP106205

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Mutations in the Schizosaccharomyces pombe Rae1 and Saccharomyces cerevisiae Gle2 genes have been shown to result in accumulation of poly-containing mRNA in the nucleus, suggesting that the encoded proteins are involved in RNA export. The protein encoded by this gene is a homolog of yeast Rae1. It contains four WD40 motifs, and has been shown to localize to distinct foci in the nucleoplasm, to the nuclear rim, and to meshwork-like structures throughout the cytoplasm. This gene is thought to be involved in nucleocytoplasmic transport, and in directly or indirectly attaching cytoplasmic mRNPs to the cytoskeleton. Alternatively spliced transcript variants encoding the same protein have been found for this gene.

Specifications

• Accession Number: P78406
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 8480
• Name: Human RAE1 (aa 284-368) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 3230401I12Rik; 41; D2Ertd342e; dJ481F12.3; dJ800J21.1; FLJ30608; HGNC:9828; homolog of yeast Rae1 (Bharathi) mRNA-associated protein of 41 kDa (Kraemer); MGC117333; MGC126076; MGC126077; MIG14; migration-inducing gene 14; MNRP; Mnrp41; mRNA export factor; mRNA export factor-like protein; mRNA export protein; mRNA-associated protein MRNP 41; mRNA-binding protein, 41-kD; MRNP41; OTTHUMP00000166110; rae1; RAE1 (RNA export 1, S.pombe) homolog; rae1 protein; rae1 protein homolog; RAE1 RNA export 1 homolog; RAE1 RNA export 1 homolog (S. pombe); ribonucleic acid export 1; RP4-800J21.2; zgc:56449; zgc:77723
• Common Name: RAE1
• Gene Symbol: RAE1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VHGTLATVGSDGRFSFWDKDARTKLKTSEQLDQPISACCFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAEELKPRNKK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining