Invitrogen™ Human RAD9B (aa 125-220) Control Fragment Recombinant Protein

Product Code. 30181393

Brand: Invitrogen™ RP97786

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (64%), Rat (64%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59236 (PA5-59236. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RAD9B gene ontology (GO) annotations include DNA repair; DNA replication; cellular response to ionizing radiation; intra-S DNA damage checkpoint; regulation of signal transduction by p53 class mediator.

Specifications

• Accession Number: Q6WBX8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 144715
• Name: Human RAD9B (aa 125-220) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: A630082N15Rik; BC021784; Cell cycle checkpoint control protein RAD9B; cell cycle checkpoint control protein RAD9B homolog; DNA repair exonuclease rad9 homolog B; hRAD9B; mRAD9B; RAD9 checkpoint clamp component B; RAD9 homolog B; RAD9B
• Common Name: RAD9B
• Gene Symbol: RAD9B
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RHGIKRTHNICFQESQPLQVIFDKNVCTNTLMIQPRLLADAIVLFTSSQEEVTLAVTPLNFCLKSSNEESMDLSNAVHSEMFVGSDEFDFFQIGMD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining