Invitrogen™ Human RAD9 (aa 56-170) Control Fragment Recombinant Protein

Product Code. 30197347

Brand: Invitrogen™ RP106175

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RAD9 is a component of the 9-1-1 cell cycle checkpoint response complex that plays a major role in DNA repair. The 9-1-1 complex is recruited to DNA lesions upon damage by the RAD17-replication factor C clamp loader complex. RAD9 acts as a sliding clamp platform on DNA for several proteins involved in long-patch base excision repair.

Specifications

• Accession Number: Q99638
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5883
• Name: Human RAD9 (aa 56-170) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Cell cycle checkpoint control protein RAD9A; chromatin-binding protein RAD9; DNA repair exonuclease rad9 homolog A; DNA repair protein RAD9; hRAD9; mRAD9; QtsA-19913; Rad9; RAD9 checkpoint clamp component A; RAD9 homolog A; RAD9 homolog A (S. pombe); Rad9a; Rad9-like protein; rCG47324-like; unnamed protein product; YD9934.02 C; YDR217C
• Common Name: RAD9
• Gene Symbol: RAD9A
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LFFQQYQAATPGQDLLRCKILMKSFLSVFRSLAMLEKTVEKCCISLNGRSSRLVVQLHCKFGVRKTHNLSFQDCESLQAVFDPASCPHMLRAPARVLGEAVLPFSPALAEVTLGI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining