Invitrogen™ Human RAD54L2 (aa 613-715) Control Fragment Recombinant Protein

Product Code. 30204656

Brand: Invitrogen™ RP96428

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Adrenergic receptors (ARs) include four general types (a1, a2, b1 and b2) that are found in different target tissues and differ in their affinities and responses to various agonists and antagonists. The coupling of ARs to specific intracellular effectors is mediated through diverse heterotrimeric G proteins. ARs play a critical role in the development of prostate cancer, and transcriptional activity of AR is partly regulated by coregulatory proteins. RAD54L2 (RAD54-like 2), also known as ARIP4 (androgen receptor-interacting protein 4), HSPC325 or SRISNF2L, is a 1,467 amino acid nuclear protein belonging to the SNF2/RAD54 helicase family that consists of one helicase ATP-binding domain and a helicase C-terminal domain. RAD54L2 is a DNA helicase that regulates androgen receptor (AR)-dependent transactivation in a promoter-dependent manner. RAD54L2 is post-translationally sumoylated or phosphorylated upon DNA damage.

Specifications

• Accession Number: Q9Y4B4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 23132
• Name: Human RAD54L2 (aa 613-715) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Androgen receptor-interacting protein 4; AR interacting protein 4; ARIP4; Helicase ARIP4; HSPC325; KIAA0809; Rad54 like 2; RAD54L2; RAD54-like 2 (S. cerevisiae); RAD54-like protein 2; RGD1561889; SRISNF2L
• Common Name: RAD54L2
• Gene Symbol: RAD54L2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KAFCVCCKIWNHPDVLYEALQKESLANEQDLDVEELGSAGTSARCPPQGTKGKGEDSTLASSMGEATNSKFLQGVGFNPFQERGNNIVTYEWAKDLLTNYQTG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining