Invitrogen™ Human RAD18 (aa 97-205) Control Fragment Recombinant Protein

Product Code. 30200071

Brand: Invitrogen™ RP89466

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (52%), Rat (52%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52602 (PA5-52602. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Human Rad18 (hRad18) is homologue of the S. pombe Rad18 (3,4). In yeast, Rad6 and Rad18 play a crucial role in post-replication repair functions in gap-filling of a daughter strand on replication of damaged DNA (2). Furthermore, Rad6-Rad18 interaction is thought to be critical at an early step during lesion bypass in yeast. In vivo, Rad18 protein forms a tight complex with Rad6 through a conserved ring-finger motif (3,4). It has been suggested that Rad18-Rad6 complex binds to the damaged sites by the single-stranded DNA binding property of Rad 18. This is followed by degradation of the stalled components of DNA replication by ubiquitin-conjugating enzyme activity of Rad6 (1). The human Rad18 maps on chromosome 3p24-25, the region which is often deleted in lung, breast, ovary, and testis cancers. The human RAD18 gene codes for a protein of 495 amino acids with a predicted molecular weight of 56 kDa. The human Rad18 is ubiquitously expressed in various human tissues.

Specifications

• Accession Number: Q9NS91
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 56852
• Name: Human RAD18 (aa 97-205) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2810024C04Rik; E3 ubiquitin-protein ligase RAD18; hHR18; hRAD18; mRAD18Sc; postreplication repair protein hRAD18p; postreplication repair protein RAD18; post-replication repair protein RAD18SC; Rad18; RAD18 E3 ubiquitin protein ligase; RAD18 homolog; RAD18 homolog (S. cerevisiae); RAD18, E3 ubiquitin protein ligase; RAD18, S. cerevisiae, homolog; Rad18sc; RING finger protein 73; RING-type E3 ubiquitin transferase RAD18; RNF73
• Common Name: RAD18
• Gene Symbol: Rad18
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LESPAKSPASSSSKNLAVKVYTPVASRQSLKQGSRLMDNFLIREMSGSTSELLIKENKSKFSPQKEASPAAKTKETRSVEEIAPDPSEAKRPEPPSTSTLKQVTKVDCP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining