missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human RAD1 (aa 162-282) Control Fragment Recombinant Protein

Product Code. 30209711
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30209711

Brand: Invitrogen™ RP89473

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52326 (PA5-52326. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Rad1 is a component of a heterotrimeric PCNA-like complex that contains Rad9 and Hus1 proteins. This complex is involved in the 9-1-1 cell cycle checkpoing response complex that plays a major role in DNA repair, by associating with Rad17 and several components of the PCNA-loading heteropentamer replication factor C. Mutants has been shown to partially restore radiation resistance and G2-checkpoint activity. It has also been shown to possess exonuclease activity.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O60671
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5810
Name Human RAD1 (aa 162-282) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias cell cycle checkpoint protein Hrad1; cell cycle checkpoint protein RAD1; checkpoint control protein HRAD1; DNA repair exonuclease rad1 homolog; DNA repair exonuclease REC1; exonuclease homolog RAD1; hRAD1; mRAD1; RAD1; RAD1 checkpoint clamp component; RAD1 checkpoint DNA exonuclease; RAD1 homolog; RAD1 homolog (S. pombe); rad1-like DNA damage checkpoint protein; REC1
Common Name RAD1
Gene Symbol RAD1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GLREAFSELDMTSEVLQITMSPDKPYFRLSTFGNAGSSHLDYPKDSDLMEAFHCNQTQVNRYKISLLKPSTKALVLSCKVSIRTDNRGFLSLQYMIRNEDGQICFVEYYCCPDEEVPESES
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.