Invitrogen™ Human RABL3 (aa 19-96) Control Fragment Recombinant Protein

Product Code. 30194756

Brand: Invitrogen™ RP96364

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57177 (PA5-57177. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Predicted to enable GTP binding activity; GTPase activity; and protein homodimerization activity. Involved in regulation of Ras protein signal transduction and regulation of protein lipidation. Predicted to be active in endomembrane system. Implicated in pancreatic cancer.

Specifications

• Accession Number: Q5HYI8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 285282
• Name: Human RABL3 (aa 19-96) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4930553C05Rik; AA958834; RAB, member of RAS oncogene family like 3; RAB, member of RAS oncogene family-like 3; RAB, member RAS oncogene family-like 3; Rabl3; rab-like protein 3
• Common Name: RABL3
• Gene Symbol: RABL3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KSSLVHLLCQNQVLGNPSWTVGCSVDVRVHDYKEGTPEEKTYYIELWDVGGSVGSASSVKSTRAVFYNSVNGIIFVHD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining