missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human RAB8B (aa 154-207) Control Fragment Recombinant Protein

Product Code. 30200191
Click to view available options
Quantity:
100 μL
missing translation for 'unitSize'
100µL
This item is not returnable. View return policy

Product Code. 30200191

missing translation for 'mfr': Invitrogen™ RP105589

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67354 (PA5-67354. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The Ras-related superfamily of guanine nucleotide binding proteins, which includes the R-Ras, Rap, Ral/Rec and Rho/Rab superfamilies exhibit 30-60% homology with Ras p21. Accumulating data suggests an important role for Rab proteins, either in endocytosis or in biosynthetic protein transport. The transport of newly synthesized proteins from the endoplasmic reticulum to various stacks of the Golgi complex and to secretory vesicles involves at each stage the movement of carrier vesicles, a process that appears to involve Rab protein function. Rab 8B (Ras-related protein Rab-8B) is a 207 amino acid lipid anchor that localizes to the cytoplasmic side of the cell membrane and belongs to the Rab family and small GTPase superfamily. Rab 8B may be involved in neurotransmitter release and vesicular trafficking, and is encoded by a gene located on human chromosome Rab 8B and mouse chromosome 9 C.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q92930
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 51762
Name Human RAB8B (aa 154-207) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 5930437D16; D330025I23Rik; FLJ38125; GTPase Rab8b; LOW QUALITY PROTEIN: ras-related protein Rab-8 B; RAB44, member RAS oncogene family; RAB8B; RAB-8 b protein; RAB8B, member RAS oncogene family; rab8bb; ras-related protein Rab-8 B; ras-related protein Rab-8 B; LOW QUALITY PROTEIN: ras-related protein Rab-8 B; Ras-related protein Rab-8 B-like protein; Unknown (protein for MGC:127591); zgc:165529
Common Name RAB8B
Gene Symbol RAB8B
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SSANVEEAFFTLARDIMTKLNRKMNDSNSAGAGGPVKITENRSKKTSFFRCSLL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.