Invitrogen™ Human RAB43 (aa 171-208) Control Fragment Recombinant Protein

Product Code. 30210147

Brand: Invitrogen™ RP103801

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63813 (PA5-63813. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different set of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. The low intrinsic GTPase activity of RAB43 is activated by USP6NL. Involved in retrograde transport from the endocytic pathway to the Golgi apparatus. Involved in the transport of Shiga toxin from early and recycling endosomes to the trans-Golgi network. Required for the structural integrity of the Golgi complex. Plays a role in the maturation of phagosomes that engulf pathogens, such as S.aureus and M.tuberculosis.

Specifications

• Accession Number: Q86YS6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 339122
• Name: Human RAB43 (aa 171-208) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1810048P08Rik; 2500004H21Rik; AW490415; RAB11B; RAB41; Rab43; RAB43, member RAS oncogene family; ras-related protein Rab-41; Ras-related protein Rab-43
• Common Name: RAB43
• Gene Symbol: RAB43
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EAFLRVATELIMRHGGPLFSEKSPDHIQLNSKDIGEGW
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining