missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human RAB3GAP2 (aa 192-284) Control Fragment Recombinant Protein

Product Code. 30193817
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30193817

Brand: Invitrogen™ RP94141

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene belongs to the RAB3 protein family, members of which are involved in regulated exocytosis of neurotransmitters and hormones. This protein forms the Rab3 GTPase-activating complex with RAB3GAP1, where it constitutes the regulatory subunit, whereas the latter functions as the catalytic subunit. This gene has the highest level of expression in the brain, consistent with it having a key role in neurodevelopment. Mutations in this gene are associated with Martsolf syndrome.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9H2M9
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 25782
Name Human RAB3GAP2 (aa 192-284) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1110059F07Rik; 2010002H18Rik; 5830469C09; AI851069; AW743433; KIAA0839; mKIAA0839; p150; RAB3 GTPase activating non-catalytic protein subunit 2; RAB3 GTPase activating protein subunit 2; RAB3 GTPase activating protein subunit 2 (non-catalytic); Rab3 GTPase-activating protein 150 kDa subunit; Rab3 GTPase-activating protein non-catalytic subunit; rab3-GAP p150; Rab3-GAP regulatory subunit; RAB3GAP150; RAB3-GAP150; RAB3GAP2; RGAP-iso; RGD1311518; SPG69; WARBM2
Common Name RAB3GAP2
Gene Symbol RAB3GAP2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence TYEIPRHPGVTEQNEELSILYPAAIVTIDGFSLFQSLRACRNQVAKAAASGNENIQPPPLAYKKWGLQDIDTIIDHASVGIMTLSPFDQMKTA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.