Invitrogen™ Human RAB3GAP2 (aa 192-284) Control Fragment Recombinant Protein

Product Code. 30193817

Brand: Invitrogen™ RP94141

Beschreibung

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene belongs to the RAB3 protein family, members of which are involved in regulated exocytosis of neurotransmitters and hormones. This protein forms the Rab3 GTPase-activating complex with RAB3GAP1, where it constitutes the regulatory subunit, whereas the latter functions as the catalytic subunit. This gene has the highest level of expression in the brain, consistent with it having a key role in neurodevelopment. Mutations in this gene are associated with Martsolf syndrome.

Spezifikation

• Accession Number: Q9H2M9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 25782
• Name: Human RAB3GAP2 (aa 192-284) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1110059F07Rik; 2010002H18Rik; 5830469C09; AI851069; AW743433; KIAA0839; mKIAA0839; p150; RAB3 GTPase activating non-catalytic protein subunit 2; RAB3 GTPase activating protein subunit 2; RAB3 GTPase activating protein subunit 2 (non-catalytic); Rab3 GTPase-activating protein 150 kDa subunit; Rab3 GTPase-activating protein non-catalytic subunit; rab3-GAP p150; Rab3-GAP regulatory subunit; RAB3GAP150; RAB3-GAP150; RAB3GAP2; RGAP-iso; RGD1311518; SPG69; WARBM2
• Common Name: RAB3GAP2
• Gene Symbol: RAB3GAP2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TYEIPRHPGVTEQNEELSILYPAAIVTIDGFSLFQSLRACRNQVAKAAASGNENIQPPPLAYKKWGLQDIDTIIDHASVGIMTLSPFDQMKTA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining