Invitrogen™ Human RAB3a (aa 70-212) Control Fragment Recombinant Protein

Product Code. 30208824

Brand: Invitrogen™ RP101053

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Rab proteins belong to the Ras small GTPase superfamily. The GTP-binding Rab3 subfamily has 4 known isoforms: 3A, 3B, 3C, and 3D. These proteins are expressed in highest concentrations in brain and endocrine tissues and involved in regulated exocytosis of hormones and neurotransmitters. Specifically, Rab 3s are thought to play a key role in presynaptic vesicle trafficking and priming.

Specifications

• Accession Number: P20336
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5864
• Name: Human RAB3a (aa 70-212) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: C18A3.6; RAB3; Rab3a; RAB3A, member RAS oncogene family; RAS-associated protein RAB3A; ras-related protein Rab-3 A; ras-related protein Rab-3 A-like protein; Ras-related small GTP binding protein 3 A
• Common Name: RAB3a
• Gene Symbol: RAB3A
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVLLVGNKCDMEDERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLVDVICEKMSESLDTADPAVTGAKQGPQLSDQQV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining