Invitrogen™ Human RAB23 (aa 81-149) Control Fragment Recombinant Protein

Product Code. 30208495

Brand: Invitrogen™ RP94676

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56067 (PA5-56067. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The Ras-related superfamily of guanine nucleotide binding proteins includes the R-Ras, Rap, Ral/Rec and Rho/Rab subfamilies. Increasing data suggests an important role for Rab proteins in either endocytosis or in biosynthetic protein transport. The process of transporting newly synthesized proteins from the endoplasmic reticulum to various stacks of the Golgi complex and to secretory vesicles involves the movement of carrier vesicles and requires Rab protein function. Rab proteins are also an integral part of endocytic pathways. Rab 23, also known as HSPC137, is a 237 amino acid member of the Rab family of proteins and localizes to the cytoplasmic side of the cell membrane. Rab 23 is believed to play a role in intracellular protein transportation and signal transduction mediated by small GTPases. Mutations in the gene encoding Rab 23 may result in Carpenter syndrome, also known as ACPS2 (acrocephalopolysyndactyly type 2), a condition characterized by obesity, cardiac defects, polysyndactyly and craniosynostosis.

Specifications

• Accession Number: Q9ULC3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51715
• Name: Human RAB23 (aa 81-149) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AW545388; DKFZp781H0695; HSPC137; MGC8900; opb; opb2; open brain 2; OTTHUMP00000040021; protein open brain; RAB 23; RAB family small GTP binding protein RAB 23; rab-15; RAB23; RAB23, member RAS oncogene family; ras-related protein Rab-23; RP3-496N17.3
• Common Name: RAB23
• Gene Symbol: RAB23
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GAQACVLVFSTTDRESFEAVSSWREKVVAEVGDIPTVLVQNKIDLLDDSCIKNEEAEALAKRLKLRFYR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining