Invitrogen™ Human RAB19 (aa 127-165) Control Fragment Recombinant Protein

Product Code. 30211172

Brand: Invitrogen™ RP100960

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62310 (PA5-62310. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RAB19 gene ontology annotations related to this gene include endoplasmic reticulum to Golgi vesicle-mediated transport; intracellular protein transport; Rab protein signal transduction.

Specifications

• Accession Number: A4D1S5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 401409
• Name: Human RAB19 (aa 127-165) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: GTP-binding protein RAB19B; hypothetical protein LOC506911; Rab19; RAB19, member RAS oncogene family; RAB19B; Ras-related protein Rab-19; ras-related protein Rab-19-like; zmp:0000001111
• Common Name: RAB19
• Gene Symbol: RAB19
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LIGNKCDLWEKRHVLFEDACTLAEKYGLLAVLETSAKES
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining