Invitrogen™ Human Rab11fip4 (aa 91-177) Control Fragment Recombinant Protein

Product Code. 30212417

Brand: Invitrogen™ RP93254

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (73%), Rat (73%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54465 (PA5-54465. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Proteins of the large Rab GTPase family have regulatory roles in the formation, targeting, and fusion of intracellular transport vesicles. RAB11FIP4 is one of many proteins that interact with and regulate Rab GTPases.

Specifications

• Accession Number: Q86YS3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 84440
• Name: Human Rab11fip4 (aa 91-177) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: A730072L08Rik; ARFO2; Arfophilin-2; FIP4-Rab11; Kiaa1821; mKIAA1821; mRab11-FIP4A; RAB11 family interacting protein 4; RAB11 family interacting protein 4 (class II); rab11 family-interacting protein 4; Rab11fip4; RAB11-FIP4
• Common Name: RAB11FIP4
• Gene Symbol: RAB11FIP4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VLSVESAGTLPCAPEIPDCVEQGSEVTGPTFADGELIPREPGFFPEDEEEAMTLAPPEGPQELYTDSPMESTQSLEGSVGSPAEKDG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining