Invitrogen™ Human RAB11FIP2 (aa 192-284) Control Fragment Recombinant Protein

Product Code. 30209955

Brand: Invitrogen™ RP97030

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58078 (PA5-58078. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RAB11FIP2 is an adapter protein that plays a role in the secretory pathway. It is thought to be important for endosome recycling and receptor-mediated endocytosis. In endosome recycling, RAB11-FIP2 regulates vesicle transport from the endosomal recycling compartment (ERC) to the plasma membrane.

Specifications

• Accession Number: Q7L804
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 22841
• Name: Human RAB11FIP2 (aa 192-284) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4930470G04Rik; A830046J09Rik; AW558126; KIAA0941; nRip11; RAB11 family interacting protein 2; RAB11 family interacting protein 2 (class I); rab11 family-interacting protein 2; rab11-family interacting protein 2; Rab11fip2; Rab11-FIP2; RAB11-FIP2 long isoform; RGD1308538
• Common Name: RAB11FIP2
• Gene Symbol: RAB11FIP2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: HMPDANSEFSSGEIQMKSKPKKPFLLGPQRLSSAHSMSDLSGSHMSSEKLKAGTIGQTHLLGHQLDSFGTVPESGSLKSPHRRTLSFDTSKMN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining