Invitrogen™ Human RAB11FIP1 (aa 779-846) Control Fragment Recombinant Protein

Product Code. 30212528

Brand: Invitrogen™ RP93849

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (43%), Rat (43%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54950 (PA5-54950. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Rab11-FIP1 (Rab 11 family-interacting protein 1), also known as Rab-coupling protein (RCP), is a 1283 amino acid Rab 11 effector protein. Rab11-FIP1, by interacting with Rab GTPases, is involved in the endosomal recycling process and may play a role in controlling membrane trafficking along the phagocytic pathway and during phagocytosis. Localized to the recycling endosome, the cytoplasmic membrane and phagosome membranes, Rab11-FIP1 is expressed as five isoforms produced by alternative splicing. As the most highly expressed isoform, isoform two of Rab11-FIP1 is expressed in brain, lung, testis, small intestine, spleen and heart. Isoform two of Rab11-FIP1 also has been found to form a homooligomer and is believed to interact with many Rab GTPases, including Rab 4A, Rab 11A, Rab 11B and Rab 25.

Specifications

• Accession Number: Q6WKZ4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 80223
• Name: Human RAB11FIP1 (aa 779-846) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2010200K21Rik; 4833414G05Rik; CBBM; CBP; hCG_41347; NOEL1A; Rab coupling protein; Rab effector protein; RAB11 coupling protein; RAB11 family interacting protein 1; RAB11 family interacting protein 1 (class I); rab11 family-interacting protein 1; RAB11FIP1; Rab11-FIP1; rab11fip1 {ECO:0000250; rab-coupling protein; Rab-interacting recycling protein; Rcp; RGD1562965; UniProtKB:Q6WKZ4}
• Common Name: RAB11FIP1
• Gene Symbol: RAB11FIP1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ASVPSIDSMMRKLEEMGLNLRKDQKKTKKRVSFSEQLFTEEAVAGAALLVEGHSSCPQELNPAWSVAG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining