Invitrogen™ Human R3HCC1 (aa 15-114) Control Fragment Recombinant Protein

Product Code. 30210709

Brand: Invitrogen™ RP93754

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54710 (PA5-54710. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

R3HCC1 gene ontology annotations related to this gene include nucleic acid binding.

Specifications

• Accession Number: Q9Y3T6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 203069
• Name: Human R3HCC1 (aa 15-114) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1700020M16Rik; AA407796; R3H and coiled-coil domain-containing protein 1; R3H domain and coiled-coil containing 1; R3HCC1; RGD1311790
• Common Name: R3HCC1
• Gene Symbol: R3HCC1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ENDFVHRIQEELDRFLLQKQLSKVLLFPPLSSRLRYLIHRTAENFDLLSSFSVGEGWKRRTVICHQDIRVPSSDGLSGPCRAPASCPSRYHGPRPISNQG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining