Invitrogen™ Human QSOX1 (aa 101-192) Control Fragment Recombinant Protein

Product Code.	Quantity	unitSize
30181532	100 μL	100µL

Artikelnummer. 30181532 missing translation for 'mfr' Invitrogen™ missing translation for 'supplierNo' RP99851

Beschreibung

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59881 (PA5-59881. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The QSOX1 gene, also known as Quiescin Q6, is a fusion of two ancient genes: thioredoxin and ERV1. Its expression is induced as fibroblasts begin to exit the proliferative cycle and enter quiescence, suggesting that this gene plays an important role in growth regulation. The QSOX1 protein oxidizes sulfhydryl groups to form disulfide bonds in proteins. QSOX1 expression is induced by hypoxia and appears to protect cells against oxidative stress-induced apoptosis.

Spezifikation

• Accession Number: O00391
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5768
• Name: Human QSOX1 (aa 101-192) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1300003H02Rik; FAD-dependent sulfhydryl oxidase-2; hQSOX; mSOx; Q6; Qscn6; Qsox; QSO x 1; Quiescin Q6; quiescin Q6 sulfhydryl oxidase 1; quiescin sulfhydryl oxidase 1; RP11-502H18.3; rQSOX; rSOx; Skin sulfhydryl oxidase; Sox; So x 2; Sox-2; Sulfhydryl oxidase 1; testis tissue sperm-binding protein Li 62 n; thiol oxidase 1; UNQ2520/PRO6013
• Common Name: QSOX1
• Gene Symbol: Qsox1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: CAEETNSAVCRDFNIPGFPTVRFFKAFTKNGSGAVFPVAGADVQTLRERLIDALESHHDTWPPACPPLEPAKLEEIDGFFARNNEEYLALIF
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining