missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human QSOX1 (aa 101-192) Control Fragment Recombinant Protein

Product Code. 30181532
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30181532

Brand: Invitrogen™ RP99851

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59881 (PA5-59881. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The QSOX1 gene, also known as Quiescin Q6, is a fusion of two ancient genes: thioredoxin and ERV1. Its expression is induced as fibroblasts begin to exit the proliferative cycle and enter quiescence, suggesting that this gene plays an important role in growth regulation. The QSOX1 protein oxidizes sulfhydryl groups to form disulfide bonds in proteins. QSOX1 expression is induced by hypoxia and appears to protect cells against oxidative stress-induced apoptosis.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O00391
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5768
Name Human QSOX1 (aa 101-192) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1300003H02Rik; FAD-dependent sulfhydryl oxidase-2; hQSOX; mSOx; Q6; Qscn6; Qsox; QSO x 1; Quiescin Q6; quiescin Q6 sulfhydryl oxidase 1; quiescin sulfhydryl oxidase 1; RP11-502H18.3; rQSOX; rSOx; Skin sulfhydryl oxidase; Sox; So x 2; Sox-2; Sulfhydryl oxidase 1; testis tissue sperm-binding protein Li 62 n; thiol oxidase 1; UNQ2520/PRO6013
Common Name QSOX1
Gene Symbol Qsox1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence CAEETNSAVCRDFNIPGFPTVRFFKAFTKNGSGAVFPVAGADVQTLRERLIDALESHHDTWPPACPPLEPAKLEEIDGFFARNNEEYLALIF
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.