Invitrogen™ Human QIL1 (aa 22-114) Control Fragment Recombinant Protein

Product Code. 30182373

Brand: Invitrogen™ RP99183

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60074 (PA5-60074. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Component of the MICOS complex, a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane. Constituent of mature MICOS complex, it is required for the formation of cristae junction (CJ) and maintenance of cristae morphology. Required for the incorporation of MICOS10/MIC10 into the MICOS complex. [UniProt]

Specifications

• Accession Number: Q5XKP0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 125988
• Name: Human QIL1 (aa 22-114) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2410015M20Rik; C19orf70; chromosome 19 open reading frame 70; MIC13; MICOS complex subunit MIC13; Micos13; P117; Protein P117; protein QIL1; QIL1; RIKEN cDNA 2410015M20 gene; sr104
• Common Name: QIL1
• Gene Symbol: MICOS13
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VYLVYDQELLGPSDKSQAALQKAGEVVPPAMYQFSQYVCQQTGLQIPQLPAPPKIYFPIRDSWNAGIMTVMSALSVAPSKAREYSKEGWEYVK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining