Invitrogen™ Human PYK2 (aa 749-832) Control Fragment Recombinant Protein

Product Code. 30194772

Brand: Invitrogen™ RP95203

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82904 (PA5-82904. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PTK2B (FAK2) is a cytoplasmic tyrosine kinase involved in calcium-induced regulation of ion channels and activation of the map kinase signaling pathway. PTK2B regulates reorganization of the actin cytoskeleton, cell polarization, cell migration, adhesion, spreading, and bone remodeling. FAK2 plays a role in the regulation of the humoral immune response and is required for normal levels of marginal B-cells in the spleen and normal migration of splenic B-cells. It functions in signaling downstream of integrin and collagen receptors, immune receptors, G-protein coupled receptors, cytokine, chemokine, and growth factor receptors, and mediates responses to cellular stress. Aberrant FAK2 expression may play a role in cancer cell proliferation, migration, and invasion in tumor formation and metastasis. Elevated expression has been seen in gliomas, hepatocellular carcinoma, lung cancer, and breast cancer.

Specifications

• Accession Number: Q14289
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 2185
• Name: Human PYK2 (aa 749-832) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: CADTK; CAK beta; CAKB; CAKbeta; CAK-beta; calcium-dependent tyrosine kinase; Calcium-regulated non-receptor proline-rich tyrosine kinase; cell adhesion kinase beta; cellular adhesion kinase beta; E430023O05Rik; FADK; FADK 2; FADK2; FAK; FAK1; FAK2; focal adhesion kinase 2; FRNK; PKB; pp125FAK; proline-rich tyrosine kinase 2; protein kinase B; protein tyrosine kinase 2 beta; protein-tyrosine kinase 2-beta; PTK; PTK2 protein tyrosine kinase 2 beta; PTK2B; PTK2B protein tyrosine kinase 2 beta; PYK2; RAFTK; related adhesion focal tyrosine kinase
• Common Name: PYK2
• Gene Symbol: PTK2B
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TLTSPMEYPSPVNSLHTPPLHRHNVFKRHSMREEDFIQPSSREEAQQLWEAEKVKMRQILDKQQKQMVEDYQWLRQEEKSLDPM
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining