Invitrogen™ Human PYGO2 (aa 210-332) Control Fragment Recombinant Protein

Product Code. 30200787

Brand: Invitrogen™ RP89384

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82841 (PA5-82841. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Involved in signal transduction through the Wnt pathway. [UniProt]

Specifications

• Accession Number: Q9BRQ0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 90780
• Name: Human PYGO2 (aa 210-332) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1190004M21Rik; mpygo2; PP7910; PYGO2; pygopus 2; pygopus family PHD finger 2; pygopus homolog 2; RGD1308535
• Common Name: PYGO2
• Gene Symbol: PYGO2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SLSQRFAQPGAPFGPSPLQRPGQGLPSLPPNTSPFPGPDPGFPGPGGEDGGKPLNPPASTAFPQEPHSGSPAAAVNGNQPSFPPNSSGRGGGTPDANSLAPPGKAGGGSGPQPPPGLVYPCGA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining