Invitrogen™ Human PYCRL Control Fragment Recombinant Protein

Product Code. 30199638

Brand: Invitrogen™ RP108905

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (73%), Rat (73%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PYCRL encodes a protein that belongs to the pyrroline-5-carboxylate reductase family of enzymes. Members of this family catalyze the final step in proline biosynthesis, converting pyrroline-5-carboxylate to proline. Glutamate and ornithine are precursors in the synthesis of proline. The protein encoded by this gene is a cytoplasmic enzyme involved in the biosynthesis of proline from ornithine.

Specifications

• Accession Number: Q53H96
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 65263
• Name: Human PYCRL Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1110058B13Rik; 2700073G24Rik; P5C reductase 3; P5CR 3; PYCR3; Pycrl; pyrroline-5-carboxylate reductase 3; pyrroline-5-carboxylate reductase-like; pyrroline-5-carboxylate reductase-like protein
• Common Name: PYCRL
• Gene Symbol: PYCR3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GVRGNKMAAAEPSPRRVGFVGAGRMAGAIAQGLIRAGKVEAQHILASAPTDRNLCHFQALGCRTTHSNQEVLQSCLLVIFATKPHVLPA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining