Invitrogen™ Human PXR (aa 103-185) Control Fragment Recombinant Protein

Product Code. 30212064

Brand: Invitrogen™ RP107955

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene product belongs to the nuclear receptor superfamily, members of which are transcription factors characterized by a ligand-binding domain and a DNA-binding domain. The encoded protein is a transcriptional regulator of the cytochrome P450 gene CYP3A4, binding to the response element of the CYP3A4 promoter as a heterodimer with the 9-cis retinoic acid receptor RXR. It is activated by a range of compounds that induce CYP3A4, including dexamethasone and rifampicin. Several alternatively spliced transcripts encoding different isoforms, some of which use non-AUG translation initiation codon, have been described for this gene. Additional transcript variants exist, however, they have not been fully characterized.

Specifications

• Accession Number: O75469
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 8856
• Name: Human PXR (aa 103-185) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: BXR; mPXR; Nr1i2; Nuclear receptor subfamily 1 group I member 2; nuclear receptor subfamily 1, group 1, member 2; nuclear receptor subfamily 1, group I, member 2; ONR 1; ONR1; orphan nuclear receptor PAR1; Orphan nuclear receptor PXR; PAR; PAR 1; PAR 2; PAR q; PAR1; PAR2; PARq; pregnane x nuclear receptor variant 2; Pregnane x receptor; pregnane x receptor (nuclear receptor sub family 1, group I, member 2); PRR; PXR; PXR0.1; PXR0.2; PXR1; SAR; Steroid and xenobiotic receptor; SXR
• Common Name: PXR
• Gene Symbol: NR1I2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LESGMKKEMIMSDEAVEERRALIKRKKSERTGTQPLGVQGLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRLPGVLSSGCELP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining