Invitrogen™ Human PWWP2B (aa 11-80) Control Fragment Recombinant Protein

Product Code. 30212239

Brand: Invitrogen™ RP109668

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-140013 (PA5-140013. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PWWP2B is a protein coding gene.

Specifications

• Accession Number: Q6NUJ5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 170394
• Name: Human PWWP2B (aa 11-80) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: bA432J24.1; pp8607; PWWP domain containing 2; PWWP domain containing 2 B; PWWP domain-containing protein 2 B; PWWP2; PWWP2B
• Common Name: PWWP2B
• Gene Symbol: PWWP2B
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VRVEQVVNGALVVTVSCGERSFAGILLDCTKKSGLFGLPPLAPLPQVDESPVNDSHGRAPEEGDAEVMQL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining