Invitrogen™ Human PUS7L (aa 202-290) Control Fragment Recombinant Protein

Product Code. 30182316

Brand: Invitrogen™ RP97741

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63611 (PA5-63611. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Pseudouridylate synthase that catalyzes pseudouridylation of RNAs. [UniProt]

Specifications

• Accession Number: Q9H0K6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 83448
• Name: Human PUS7L (aa 202-290) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: pseudouridylate synthase 7 homolog (S. cerevisiae)-like; pseudouridylate synthase 7 homolog-like protein; pseudouridylate synthase 7 like; pseudouridylate synthase 7-like; PUS7L
• Common Name: PUS7L
• Gene Symbol: PUS7L
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EYKELCHLVSEEEAFDFFKYLDAKKENSKFTFKPDTNKDHRKAVHHFVNKKFGNLVETKSFSKMNCSAGNPNVVVTVRFREKAHKRGKR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining