Invitrogen™ Human PURG (aa 15-63) Control Fragment Recombinant Protein

Product Code. 30206165

Brand: Invitrogen™ RP100231

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61583 (PA5-61583. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The exact function of this gene is not known, however, its encoded product is highly similar to purine-rich element binding protein A. The latter is a DNA-binding protein which binds preferentially to the single strand of the purine-rich element termed PUR, and has been implicated in the control of both DNA replication and transcription. PURG lies in close proximity to the Werner syndrome gene, but on the opposite strand, on chromosome 8p11. Two transcript variants encoding different isoforms have been found for this gene.

Specifications

• Accession Number: Q9UJV8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 29942
• Name: Human PURG (aa 15-63) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4930486B15Rik; MGC119274; Purg; PURG-A; Pur-gamma; PURG-B; purine rich element binding protein G; purine-rich element binding protein G; Purine-rich element-binding protein G; Purine-rich element-binding protein gamma
• Common Name: PURG
• Gene Symbol: PURG
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RGGKNVGGSGLSKSRLYPQAQHSHYPHYAASATPNQAGGAAEIQELASK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining