Invitrogen™ Human PUM2 (aa 181-237) Control Fragment Recombinant Protein

Product Code. 30207283

Brand: Invitrogen™ RP95963

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56436 (PA5-56436. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

LZTS2 is a negative regulator of katanin-mediated microtubule severing and release from the centrosome. LZTS2 is required for central spindle formation and the completion of cytokinesis.

Specifications

• Accession Number: Q8TB72
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 23369
• Name: Human PUM2 (aa 181-237) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 5730503J23Rik; FLJ36528; KIAA0235; MGC138251; MGC138253; mKIAA0235; OTTHUMP00000200539; PUM1; Pum2; PUMH2; pumilio 2; pumilio homolog 2; pumilio RNA binding family member 2; pumilio RNA-binding family member 2; pumilio-2; PUML2; Pumm2
• Common Name: PUM2
• Gene Symbol: PUM2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ASPTEVVERLGPNTNPSEGLGPLPNPTANKPLVEEFSNPETQNLDAMEQVGLESLQF
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining