Invitrogen™ Human PUF60 (aa 213-294) Control Fragment Recombinant Protein

Product Code. 30193767

Brand: Invitrogen™ RP104072

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84430 (PA5-84430. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PUF60 encodes a protein that is a Ro RNP-binding protein. It interacts with Ro RNPs and their interaction is thought to represent a gain of function for Ro RNPs. This protein also forms a ternary complex with far upstream element (FUSE) and FUSE-binding protein. It can repress a c-myc reporter via the FUSE. It is also known to target transcription factor IIH and inhibit activated transcription. This gene is implicated in the xeroderma pigmentosum disorder. There are two alternatively spliced transcript variants of this gene encoding different isoforms. There seems to be evidence of multiple polyadenylation sites for this gene.

Specifications

• Accession Number: Q9UHX1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 22827
• Name: Human PUF60 (aa 213-294) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2410104I19Rik; 2810454F19Rik; 60 kDa poly(U)-binding-splicing factor; FBP interacting repressor; FBP-interacting repressor; FIR; FLJ31379; FUSE-binding protein-interacting repressor; LOW QUALITY PROTEIN: poly(U)-binding-splicing factor PUF60; poly(U) binding splicing factor 60; poly(U) binding splicing factor 60 KDa; poly(U)-binding-splicing factor PUF60; poly-U binding splicing factor 60; poly-U binding splicing factor 60 K; poly-U binding splicing factor 60 KDa; PUF60; pyrimidine tract binding splicing factor; RNA-binding protein Siah-BP; Ro ribonucleoprotein-binding protein 1; Ro-binding protein 1; RoBP1; ROBPI; Siah binding protein 1; siah binding protein 1; FBP interacting repressor; pyrimidine tract binding splicing factor; Ro ribonucleoprotein-binding protein 1; siah-binding protein 1; SIAHBP1; Siah-BP1; similar to fuse-binding protein-interacting repressor isoform a; VRJS
• Common Name: PUF60
• Gene Symbol: Puf60
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PIIDQLAEEARAFNRIYVASVHQDLSDDDIKSVFEAFGKIKSCTLARDPTTGKHKGYGFIEYEKAQSSQDAVSSMNLFDLGG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining