missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human PTPRU (aa 28-111) Control Fragment Recombinant Protein

Product Code. 30199811
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30199811

Brand: Invitrogen™ RP94968

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58948 (PA5-58948. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP possesses an extracellular region, a single transmembrane region, and two tandem intracellular catalytic domains, and thus represents a receptor-type PTP. The extracellular region contains a meprin-A5 antigen-PTP (MAM) domain, Ig-like and fibronectin type III-like repeats. This PTP was thought to play roles in cell-cell recognition and adhesion. Studies of the similar gene in mice suggested the role of this PTP in early neural development. The expression of this gene was reported to be regulated by phorbol myristate acetate (PMA) or calcium ionophore in Jurkat T lymphoma cells. Alternatively spliced transcript variants have been reported.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q92729
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10076
Name Human PTPRU (aa 28-111) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias FMI; Ftp-1; GLEPP1; hPTP-J; Pancreatic carcinoma phosphatase 2; Pcp2; PCP-2; pi R-PTP-Psi; protein tyrosine phosphatase, receptor type U; protein tyrosine phosphatase, receptor type, L; protein tyrosine phosphatase, receptor type, U; protein-tyrosine phosphatase J; Protein-tyrosine phosphatase pi; protein-tyrosine phosphatase receptor omicron; Protein-tyrosine phosphatase-lamda; PTP; PTP pi; Ptpf; PTP-J; PTPlambda; PTP-lambda; PTP-PI; PTPPSI; Ptprl; PTPRO; PTP-RO; PTPRU; PTPU2; Receptor protein tyrosine phosphatase hPTP-J; receptor-type protein-tyrosine phosphatase psi; Receptor-type tyrosine-protein phosphatase U; RPTPlambda; R-PTP-psi; R-PTP-U
Common Name PTPRU
Gene Symbol PTPRU
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence TFEEASDPAVPCEYSQAQYDDFQWEQVRIHPGTRAPADLPHGSYLMVNTSQHAPGQRAHVIFQSLSENDTHCVQFSYFLYSRDG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.