missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human PTPRN (aa 259-371) Control Fragment Recombinant Protein

Product Code. 30200908
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30200908

Brand: Invitrogen™ RP88661

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-64913 (PA5-64913, PA5-52396 (PA5-52396. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

IA-2 (insulinoma-associated protein 2, ICA512, PTPRN) is a member of the transmembrane protein tyrosine phosphatase (PTP) family located in secretory granules of neuroendocrine cells. The IA-2 protein is 979 amino acids in length and consists of a luminal domain, transmembrane domain, and cytoplasmic domain. Although a member of the PTP family, IA-2 lacks phosphatase activity with known substrates due to amino acid substitutions at critical sites in its PTP domain. Two paralog RPTPs, IA-2 and IA-2beta were identified as major autoantigens in type-1 diabetes mellitus. On granule exocytosis, the IA-2 cytoplasmic domain is cleaved and the resulting cytosolic fragment moves into the nucleus where it enhances the levels of phosphorylated STAT5 and STAT3, thereby inducing insulin gene transcription and granule biogenesis. IA-2 signaling enhances pancreatic beta-cell proliferation by regulating cyclins D through STATs.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q16849
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5798
Name Human PTPRN (aa 259-371) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 105 kDa islet cell antigen; BEM-3; brain-enriched membrane-associated protein tyrosine phosphatase; IA2; IA-2; IA-2/PTP; ICA 512; ICA105; ICA3; ICA512; ICA512-CCF; ICA512-cleaved cytosolic fragment; ICA512-N-terminal fragment; ICA512-NTF; ICA512-TMF; ICA512-transmembrane fragment; islet cell antigen 2; islet cell antigen 512; Islet cell autoantigen 3; mIA-A; mKIAA4064; protein tyrosine phosphatase, receptor type N; protein tyrosine phosphatase, receptor type, N; protein tyrosine phosphatase, receptor-type, N; protein tyrosine phosphatase-like N; PTP IA-2; PTPLP; Ptprn; receptor-type tyrosine-protein phosphatase-like N; R-PTP-N
Common Name PTPRN
Gene Symbol PTPRN
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence HSYGDLPGPSPAQLFQDSGLLYLAQELPAPSRARVPRLPEQGSSSRAEDSPEGYEKEGLGDRGEKPASPAVQPDAALQRLAAVLAGYGVELRQLTPEQLSTLLTLLQLLPKGA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.