Invitrogen™ Human PTPRG (aa 37-135) Control Fragment Recombinant Protein

Product Code. 30200723

Brand: Invitrogen™ RP107321

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66673 (PA5-66673. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RPTP gamma, also known as Receptor-type tyrosine-protein phosphatase gamma, R-PTP-gamma or PTPRG is a protein tyrosine phosphatase (PTP) is a candidate tumor suppressor gene since it is located on human chromosome 3p14.2-p21, a region frequently deleted in certain types of renal and lung carcinomas. In situ hybridization analysis reveals that RPTP gamma mRNA is expressed in specific regions of the brain and that the localization of RPTP gamma changes during brain development. RPTP gamma is composed of a putative extracellular domain, a single transmembrane domain, and a cytoplasmic portion with two tandem catalytic tyrosine phosphatase domains. The extracellular domain contains a stretch of 266 amino acids with striking homology to the zinc-containing enzyme carbonic anhydrase (CAH), indicating that RPTP gamma and RPTP beta (HPTP zeta) represent a subfamily of receptor tyrosine phosphatases. RPTP gamma may have a function other than catalysis of hydration of metabolic CO2.

Specifications

• Accession Number: P23470
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5793
• Name: Human PTPRG (aa 37-135) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 5430405N12Rik; AW046354; AW549872; H_RG317H01.1; HPTPG; protein tyrosine phosphatase gamma; protein tyrosine phosphatase, receptor type G; protein tyrosine phosphatase, receptor type, G; protein tyrosine phosphatase, receptor type, gamma polypeptide; protein-tyrosine phosphatase gamma; Protein-tyrosine phosphatase gamma precursor (R-PTP-gamma); Ptpg; Ptprg; receptor type protein tyrosine phosphatase gamma; receptor tyrosine phosphatase gamma; receptor-like protein tyrosine phosphatase gamma; receptor-type protein phosphatase gamma; receptor-type tyrosine-protein phosphatase gamma; RPTP gamma A; RPTP gamma B; RPTP gamma C; RPTP gamma S; RPTPG; RPTPgamma; R-PTP-GAMMA
• Common Name: PTPRG
• Gene Symbol: PTPRG
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ALHENRHGSAVQIRRRKASGDPYWAYSGAYGPEHWVTSSVSCGGRHQSPIDILDQYARVGEEYQELQLDGFDNESSNKTWMKNTGKTVAILLKDDYFVS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining