Invitrogen™ Human PTPN7 (aa 190-326) Control Fragment Recombinant Protein

Product Code. 30200930

Brand: Invitrogen™ RP91566

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53927 (PA5-53927. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a member of the protein tyrosine phosphatase family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This gene is preferentially expressed in a variety of hematopoietic cells, and is an early response gene in lymphokine stimulated cells. The noncatalytic N-terminus of this PTP can interact with MAP kinases and suppress the MAP kinase activities. This PTP was shown to be involved in the regulation of T cell antigen receptor signaling, which was thought to function through dephosphorylating the molecules related to MAP kinase pathway. Two alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Specifications

• Accession Number: P35236
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5778
• Name: Human PTPN7 (aa 190-326) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: BPTP-4; C920001D21Rik; dual specificity phosphatase 1; hematopoietic protein-tyrosine phosphatase; HEPTP; Lcptp; LC-PTP; LOW QUALITY PROTEIN: tyrosine-protein phosphatase non-receptor type 7; LPTP; protein tyrosine phosphatase non-receptor type 7; protein tyrosine phosphatase, non-receptor type 7; protein tyrosine phosphatase, non-receptor type 7 isoform 2; protein-tyrosine phosphatase LC-PTP; protein-tyrosine phosphatase, non-receptor type 7; protein-tyrosine phosphatase, nonreceptor-type, stress induced; Ptpn7; PTPNI; tyrosine-protein phosphatase non-receptor type 7
• Common Name: PTPN7
• Gene Symbol: PTPN7
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LIVMLTQLREGKEKCVHYWPTEEETYGPFQIRIQDMKECPEYTVRQLTIQYQEERRSVKHILFSAWPDHQTPESAGPLLRLVAEVEESPETAAHPGPIVVHCSAGIGRTGCFIATRIGCQQLKARGEVDILGIVCQL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining