Invitrogen™ Human PTPN22 (aa 359-449) Control Fragment Recombinant Protein

Product Code. 30196403

Brand: Invitrogen™ RP88582

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (57%), Rat (57%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52132 (PA5-52132. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein tyrosine phosphatase PTPN22 (PTP22, LYP, PEP, formerly PTPN8) is a genetic variant that confers risk of developing diverse human autoimmune diseases such as type 1 diabetes and rheumatoid arthritis. The minor allele of a missense SNP in PTPN22 encodes a hematopoietic-specific protein tyrosine phosphatase also known as 'Lyp.' The risk allele is present in about 17% of Caucasian individuals from the general population and in approximately 28% of Caucasian individuals with rheumatoid arthritis; it is thought to disrupt the P1 proline-rich motif that is important for interaction with the Src homology-3 (SH3) domain of CSK (cytoplasmic tyrosine kinase), potentially altering the normal functions of these proteins as negative regulators of T cell activation. The interaction between CSK and PTPN22 is highly specific and it is speculated that PTPN22 may be an effector and/or regulator of CSK in T cells and other hematopoietic cells.

Specifications

• Accession Number: Q9Y2R2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 26191
• Name: Human PTPN22 (aa 359-449) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 70 zpep; Hematopoietic cell protein-tyrosine phosphatase 70 Z-PEP; Lymphoid phosphatase; lymphoid-specific protein tyrosine phosphatase; LyP; LYP1; LYP2; PEP; PEST domain-enriched tyrosine phosphatase; PEST-domain phosphatase; protein tyrosine phosphatase, non-receptor type 22; protein tyrosine phosphatase, non-receptor type 22 (lymphoid); protein tyrosine phosphatase, non-receptor type 8; Ptpn22; PTPN8; tyrosine-phosphatase; Tyrosine-protein phosphatase non-receptor type 22
• Common Name: PTPN22
• Gene Symbol: Ptpn22
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SEISAKEELVLHPAKSSTSFDFLELNYSFDKNADTTMKWQTKAFPIVGEPLQKHQSLDLGSLLFEGCSNSKPVNAAGRYFNSKVPITRTKS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining