Invitrogen™ Human PTPN18 (aa 384-448) Control Fragment Recombinant Protein

Product Code. 30201139

Brand: Invitrogen™ RP108398

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (68%), Rat (68%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84151 (PA5-84151. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Differentially dephosphorylate autophosphorylated tyrosine kinases which are known to be overexpressed in tumor tissues.

Specifications

• Accession Number: Q99952
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 26469
• Name: Human PTPN18 (aa 384-448) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: BDP1; Brain-derived phosphatase; fetal liver phosphatase 1; FLP1; FLP-1; HSCF; protein tyrosine phosphatase 20; protein tyrosine phosphatase, non-receptor type 18; protein tyrosine phosphatase, non-receptor type 18 (brain-derived); PTP20; PTP-HSCF; Ptpk1; PTP-K1; Ptpn18; Tyrosine-protein phosphatase non-receptor type 18
• Common Name: PTPN18
• Gene Symbol: PTPN18
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EEAPLYSKVTPRAQRPGAHAEDARGTLPGRVPADQSPAGSGAYEDVAGGAQTGGLGFNLRIGRPK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining