Abnova™ Human PTPN1 (NP_002818, 1 a.a. - 321 a.a.) Partial Recombinant Protein

Product Code. 16181340

Brand: Abnova™ P3444.100ug

Description

Used for Func, SDS-PAGE

The protein encoded by this gene is the founding member of the protein tyrosine phosphatase (PTP) family, which was isolated and identified based on its enzymatic activity and amino acid sequence. PTPs catalyze the hydrolysis of the phosphate monoesters specifically on tyrosine residues. Members of the PTP family share a highly conserved catalytic motif, which is essential for the catalytic activity. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP has been shown to act as a negative regulator of insulin signaling by dephosphorylating the phosphotryosine residues of insulin receptor kinase. This PTP was also reported to dephosphorylate epidermal growth factor receptor kinase, as well as JAK2 and TYK2 kinases, which implicated the role of this PTP in cell growth control, and cell response to interferon stimulation. [provided by RefSeq]

Sequence: MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLEPPPEHIPPPPRPPKRILEPHN

Specifications

• Accession Number: NP_002818
• Concentration: 1 mg/mL
• For Use With (Application): Functional Study, SDS-PAGE
• Formulation: Liquid
• Gene ID (Entrez): 5770
• Molecular Weight (g/mol): 37.3kDa
• Name: PTPN1 (Human) Recombinant Protein
• Preparation Method: Escherichia coli expression system
• Purification Method: Conventional Chromatography
• Quality Control Testing: Loading 3 ug protein in 12% SDS-PAGE
• Quantity: 100 μg
• Immunogen: MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLEPPPEHIPPPPRPPKRILEPHN
• Storage Requirements: Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: PTP1B
• Common Name: PTPN1
• Gene Symbol: PTPN1
• Biological Activity: Specific activity: 6,000-12,000 units/mg. Enzymatic activity was confirmed by measuring the amount of enzyme hydrolyzing 1nmole of p-nitrophenyl phosphate (pNPP) per minute at 37°C, pH7.5 using 10mM of substrate.
• Species: E. coli
• Recombinant: Recombinant
• Protein Tag: None
• Expression System: Escherichia coli expression system
• Form: Liquid
• Purity or Quality Grade: >95% by SDS-PAGE