missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30201626

Invitrogen™ Human PTH1R (aa 476-586) Control Fragment Recombinant Protein

Product Code. 30201626
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30201626

Brand: Invitrogen™ RP89624

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Parathyroid hormone receptor 1 is a member of the G-protein coupled receptor family. This protein is a receptor for parathyroid hormone (PTH) and for parathyroid hormone-like hormone (PTHLH). The activity of this receptor is mediated by G proteins which activate adenylyl cyclase and also a phosphatidylinositol-calcium second messenger system. Defects in this receptor are known to be the cause of Jansen's metaphyseal chondrodysplasia (JMC), chondrodysplasia Blomstrand type (BOCD), as well as enchodromatosis. Parathyroid hormone receptor 1 has been reported to be expressed in bone, breast, brain, colon, GI, kidney, liver, placenta, skin, umbilical cord, and uterus.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q03431
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5745
Name Human PTH1R (aa 476-586) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias MGC138426; MGC138452; Parathormone; Parathyrin; parathyroid hormone 1 receptor; parathyroid hormone receptor; parathyroid hormone receptor 1; parathyroid hormone/parathyroid hormone-related peptide receptor; parathyroid hormone/parathyroid hormone-related protein receptor; PFE; PPR; PTH; PTH/PTHr receptor; PTH/PTHrP receptor; PTH/PTHrP type I receptor; PTH1 receptor; PTH1R; Pthr; Pthr1; PTHrel; PTH-related peptide receptor; PTHrP-R; PTHrP-receptor; seven transmembrane helix receptor
Common Name PTH1R
Gene Symbol Pth1r
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RWTLALDFKRKARSGSSSYSYGPMVSHTSVTNVGPRVGLGLPLSPRLLPTATTNGHPQLPGHAKPGTPALETLETTPPAMAAPKDDGFLNGSCSGLDEEASGPERPPALLQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.