Invitrogen™ Human PTGIS (aa 41-174) Control Fragment Recombinant Protein

Product Code. 30210672

Brand: Invitrogen™ RP108394

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111349 (PA5-111349. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CYP8A1 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. However, this protein is considered a member of the cytochrome P450 superfamily on the basis of sequence similarity rather than functional similarity. This endoplasmic reticulum membrane protein catalyzes the conversion of prostglandin H2 to prostacyclin (prostaglandin I2), a potent vasodilator and inhibitor of platelet aggregation. An imbalance of prostacyclin and its physiological antagonist thromboxane A2 contribute to the development of myocardial infarction, stroke, and atherosclerosis.

Specifications

• Accession Number: Q16647
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5740
• Name: Human PTGIS (aa 41-174) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Cyp8; CYP8A1; cytochrome P450 8A1; cytochrome P450, family 8, subfamily A, polypeptide 1; hydroperoxy icosatetraenoate dehydratase; LOW QUALITY PROTEIN: prostacyclin synthase; MGC126858; MGC126860; PGIS; Prostacyclin synthase; prostaglandin I2 (prostacyclin) synthase; prostaglandin I2 (prostacyclin) synthase like; prostaglandin I2 synthase; PTGI; ptgis; ptgisl
• Common Name: PTGIS
• Gene Symbol: PTGIS
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GYALDFGKDAASFLTRMKEKHGDIFTILVGGRYVTVLLDPHSYDAVVWEPRTRLDFHAYAIFLMERIFDVQLPHYSPSDEKARMKLTLLHRELQALTEAMYTNLHAVLLGDATEAGSGWHEMGLLDFSYSFLLR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining