Invitrogen™ Human PTF1A (aa 5-63) Control Fragment Recombinant Protein

Product Code. 30199533

Brand: Invitrogen™ RP110097

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-145036 (PA5-145036. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PFT1A is a component of the pancreas transcription factor 1 complex and is known to have a role in mammalian pancreatic development. The protein plays a role in determining whether cells allocated to the pancreatic buds continue towards pancreatic organogenesis or revert back to duodenal fates. The protein is thought to be involved in the maintenance of exocrine pancreas-specific gene expression including elastase 1 and amylase. Mutations in this gene cause cerebellar agenesis and loss of expression is seen in ductal type pancreas cancers.

Specifications

• Accession Number: Q7RTS3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 256297
• Name: Human PTF1A (aa 5-63) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: bHLH transcription factor; bHLH transcription factor p48; BHLHA29; class A basic helix-loop-helix protein 29; class II bHLH protein PTF1A; exocrine pancreas-specific transcription factor p48; p48 DNA-binding subunit of transcription factor PTF1; PACA; PAGEN2; pancreas associated transcription factor 1 A; pancreas specific transcription factor, 1 A; pancreas transcription factor 1 subunit alpha; pancreas transcription factor1 p48 subunit; pancreas-specific transcription factor 1 A; PTF1; PTF1A; PTF1p48; PTF1-p48; Ptfa; si:zc142h2.2; zgc:112216
• Common Name: PTF1A
• Gene Symbol: PTF1A
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LLEHFPGGLDAFPSSYFDEDDFFTDQSSRDPLEDGDELLADEQAEVEFLSHQLHEYCYR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining