missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human PTF1A (aa 5-63) Control Fragment Recombinant Protein

Product Code. 30199533
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30199533

Brand: Invitrogen™ RP110097

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-145036 (PA5-145036. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PFT1A is a component of the pancreas transcription factor 1 complex and is known to have a role in mammalian pancreatic development. The protein plays a role in determining whether cells allocated to the pancreatic buds continue towards pancreatic organogenesis or revert back to duodenal fates. The protein is thought to be involved in the maintenance of exocrine pancreas-specific gene expression including elastase 1 and amylase. Mutations in this gene cause cerebellar agenesis and loss of expression is seen in ductal type pancreas cancers.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q7RTS3
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 256297
Name Human PTF1A (aa 5-63) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias bHLH transcription factor; bHLH transcription factor p48; BHLHA29; class A basic helix-loop-helix protein 29; class II bHLH protein PTF1A; exocrine pancreas-specific transcription factor p48; p48 DNA-binding subunit of transcription factor PTF1; PACA; PAGEN2; pancreas associated transcription factor 1 A; pancreas specific transcription factor, 1 A; pancreas transcription factor 1 subunit alpha; pancreas transcription factor1 p48 subunit; pancreas-specific transcription factor 1 A; PTF1; PTF1A; PTF1p48; PTF1-p48; Ptfa; si:zc142h2.2; zgc:112216
Common Name PTF1A
Gene Symbol PTF1A
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LLEHFPGGLDAFPSSYFDEDDFFTDQSSRDPLEDGDELLADEQAEVEFLSHQLHEYCYR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.