Invitrogen™ Human PTCH (aa 1216-1290) Control Fragment Recombinant Protein

Product Code. 30196599

Brand: Invitrogen™ RP108034

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111728 (PA5-111728. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the patched gene family. The encoded protein is the receptor for sonic hedgehog, a secreted molecule implicated in the formation of embryonic structures and in tumorigenesis, as well as the desert hedgehog and indian hedgehog proteins. This gene functions as a tumor suppressor. Mutations of this gene have been associated with basal cell nevus syndrome, esophageal squamous cell carcinoma, trichoepitheliomas, transitional cell carcinomas of the bladder, as well as holoprosencephaly. Alternative splicing results in multiple transcript variants encoding different isoforms. Additional splice variants have been described, but their full length sequences and biological validity cannot be determined currently.

Specifications

• Accession Number: Q13635
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5727
• Name: Human PTCH (aa 1216-1290) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: A230106A15Rik; BCNS; etID309849.2; FLJ26746; FLJ42602; HGNC:9585; HPE7; lep; leprechaun; mes; mesenchymal dysplasia; NBCCS; OTTHUMP00000021709; OTTHUMP00000021710; patched; Patched 1; patched 2; patched homolog 1; patched homolog 2; patched protein; patched1; patched-2 protein; patched-like protein; protein patched homolog 1; Ptc; ptc1; ptc-1; ptc2; Ptch; PTCH protein +12 b; PTCH protein +4'; PTCH protein -10; PTCH protein -3; PTCH protein -3,4,5; PTCH1; Ptch1 protein +12 b; PTCH11; Ptch2; RP11-435O5.3
• Common Name: PTCH
• Gene Symbol: Ptch1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SGSDSSDSEYSSQTTVSGLSEELRHYEAQQGAGGPAHQVIVEATENPVFAHSTVVHPESRHHPPSNPRQQPHLDS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining