Invitrogen™ Human PTCD3 (aa 200-289) Control Fragment Recombinant Protein

Product Code. 30182603

Brand: Invitrogen™ RP98435

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (68%), Rat (68%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59544 (PA5-59544. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Mitochondrial RNA-binding protein that has a role in mitochondrial translation.

Specifications

• Accession Number: Q96EY7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 55037
• Name: Human PTCD3 (aa 200-289) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2610034F17Rik; 2810422B04Rik; 28 S ribosomal protein S39, mitochondrial; AA589622; AU045708; Mitochondrial small ribosomal subunit protein mS39; Mrps39; MRP-S39; pentatricopeptide repeat domain 3; pentatricopeptide repeat domain-containing protein 3, mitochondrial; pentatricopeptide repeat-containing protein 3, mitochondrial; Ptcd3; similar to CG4679-PA; transformation-related gene 15 protein; TRG15; TRG-15
• Common Name: PTCD3
• Gene Symbol: PTCD3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DQEPSTDYHFQQTGQSEALEEENDETSRRKAGHQFGVTWRAKNNAERIFSLMPEKNEHSYCTMIRGMVKHRAYEQALNLYTELLNNRLHA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining