Invitrogen™ Human PSRC1 (aa 3-79) Control Fragment Recombinant Protein

Product Code. 30210944

Brand: Invitrogen™ RP100942

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61931 (PA5-61931. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PSRC1 is required for normal progression through mitosis. Required for normal congress of chromosomes at the metaphase plate, and for normal rate of chromosomal segregation during anaphase. Plays a role in the regulation of mitotic spindle dynamics. Increases the rate of turnover of microtubules on metaphase spindles, and contributes to the generation of normal tension across sister kinetochores. Recruits KIF2A and ANKRD53 to the mitotic spindle and spindle poles. May participate in p53/TP53-regulated growth suppression.

Specifications

• Accession Number: Q6PGN9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 84722
• Name: Human PSRC1 (aa 3-79) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 5430413I02Rik; AL033312; Dda3; differential display and activated by p53; FP3214; MGC1780; OTTHUMP00000013785; OTTHUMP00000013786; p53-regulated DDA3; proline and serine rich coiled-coil 1; proline/serine-rich coiled-coil 1; proline/serine-rich coiled-coil protein 1; Psrc1
• Common Name: PSRC1
• Gene Symbol: PSRC1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DLEEDVRFIVDETLDFGGLSPSDSREEEDITVLVTPEKPLRRGLSHRSDPNAVAPAPQGVRLSLGPLSPEKLEEILD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining