Invitrogen™ Human PSPC1 (aa 441-523) Control Fragment Recombinant Protein

Product Code. 30182350

Brand: Invitrogen™ RP97937

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58585 (PA5-58585. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Regulates, cooperatively with NONO and SFPQ, androgen receptor-mediated gene transcription activity in Sertoli cell line. Binds to poly(A), poly(G) and poly(U) RNA homopolymers.

Specifications

• Accession Number: Q8WXF1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 55269
• Name: Human PSPC1 (aa 441-523) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 5730470C09Rik; AI327109; AI449052; mPSP1; Paraspeckle component 1; paraspeckle protein 1; PSP1; Pspc1
• Common Name: PSPC1
• Gene Symbol: PSPC1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PAMGPEGAANMGTPMMPDNGAVHNDRFPQGPPSQMGSPMGSRTGSETPQAPMSGVGPVSGGPGGFGRGSQGGNFEGPNKRRRY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining